PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G047000.1.p
Common NameGLYMA_14G047000, LOC100791704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 326aa    MW: 37172.1 Da    PI: 6.7084
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G047000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092552892155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  Glyma.14G047000.1.p 255 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 289
                          569*****************************885 PP

2ELK38.42.7e-13209230122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK qLlrKYsgyLgsLk+EF+
  Glyma.14G047000.1.p 209 ELKVQLLRKYSGYLGSLKKEFL 230
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.5E-1576120IPR005540KNOX1
PfamPF037906.9E-1978119IPR005540KNOX1
SMARTSM012562.4E-26128179IPR005541KNOX2
PfamPF037916.9E-22131177IPR005541KNOX2
SMARTSM011887.1E-7209230IPR005539ELK domain
PfamPF037892.0E-9209230IPR005539ELK domain
PROSITE profilePS5121311.139209229IPR005539ELK domain
PROSITE profilePS5007112.228229292IPR001356Homeobox domain
SMARTSM003892.8E-12231296IPR001356Homeobox domain
SuperFamilySSF466892.18E-19231303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28234295IPR009057Homeodomain-like
CDDcd000861.39E-12241293No hitNo description
PfamPF059202.9E-17249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MIGFGGNSCS ELSEMDMMNM ETNNRKFLSL PLSNNNNNSG NAQMRSSSDN RRVPVTSNSN  60
IAQEHHYSHH NPTDTCSVRD KIMAHPLFPR LLSSYLNCLK VGAPPEVVAS LEESCAKCES  120
FNASSGRTGG SIGEDPALDQ FMEAYCEMLI KYEQELTKPF KEAMLFFSRI ECQLKALAVS  180
SDFGQSETSS QNEVDVHENN LDSQAEDREL KVQLLRKYSG YLGSLKKEFL KKKKNGKLPK  240
EARQQLLDWW NRHYKWPYPS ESQKQALAES TGLDLKQINN WFINQRKRHW KPSEDMQFAV  300
MDATNYYMEN VMCKPFPMDG MPMLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.569510.0meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280610.0EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616040.0GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545568.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-118HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0R0GL540.0A0A0R0GL54_SOYBN; Uncharacterized protein
STRINGGLYMA14G05150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-107KNOX/ELK homeobox transcription factor